PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100131690231
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 310aa    MW: 35182.8 Da    PI: 6.3524
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100131690231genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like64.12.6e-20108158455
                       G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                    +Wt eLH++F+ a +qL G+ k  Pk +lelm+v+gLt+ +v+SHLQk R 
  Ote100131690231|100131690231 108 TEWTVELHAKFMAAAKQL-GQGKCYPKDVLELMNVPGLTRMQVASHLQKCRN 158
                                   58****************.9*****************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.287102161IPR017930Myb domain
SuperFamilySSF466892.87E-14103157IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-20105158IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-16108158IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MNKVMLDVDD EATTRMAVEQ GALLCVTKSM IMGILGCLWQ FMLHKRASKT PQALQEKELR  60
KCVVESNPNT NISNSEQNYK SMEKYSENEG GRLKKSGGGG RLKRKDWTEW TVELHAKFMA  120
AAKQLGQGKC YPKDVLELMN VPGLTRMQVA SHLQKCRNAS WLPPNERKQM KVETPPRKVS  180
KSGRAKTLRF GLMPFPPPEK EEDEASDNFS QTISQKYDPA DSHAFHSLEA WDDMSWNEQF  240
VYGDDQNKML SSLVSDTFPV MHSSTLHSFP DFHQHPLDMD FNGVILDQVA PVGDANNEWF  300
PDLEKDGSDH
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384